General Information

  • ID:  hor005885
  • Uniprot ID:  Q792G6
  • Protein name:  LHAL tetrapeptide
  • Gene name:  Gnas
  • Organism:  Rattus norvegicus (Rat)
  • Family:  NESP55 family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Rattus (genus), Murinae (subfamily), Muridae (family), Muroidea , Myomorpha (suborder), Rodentia (order), Glires , Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0001965 G-protein alpha-subunit binding; GO:0003924 GTPase activity; GO:0003925 G protein activity; GO:0005159 insulin-like growth factor receptor binding; GO:0005515 protein binding; GO:0005525 GTP binding; GO:0010854 adenylate cyclase regulator activity; GO:0010856 adenylate cyclase activator activity; GO:0019904 protein domain specific binding; GO:0031681 G-protein beta-subunit binding; GO:0031683 G-protein beta/gamma-subunit complex binding; GO:0031698 beta-2 adrenergic receptor binding; GO:0031748 D1 dopamine receptor binding; GO:0031852 mu-type opioid receptor binding; GO:0035255 ionotropic glutamate receptor binding; GO:0043014 alpha-tubulin binding; GO:0051430 corticotropin-releasing hormone receptor 1 binding
  • GO BP:  GO:0001501 skeletal system development; GO:0001894 tissue homeostasis; GO:0001934 positive regulation of protein phosphorylation; GO:0001958 endochondral ossification; GO:0006112 energy reserve metabolic process; GO:0006306 DNA methylation; GO:0006357 regulation of transcription by RNA polymerase II; GO:0007186 G protein-coupled receptor signaling pathway; GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway; GO:0007191 adenylate cyclase-activating dopamine receptor signaling pathway; GO:0007606 sensory perception of chemical stimulus; GO:0008284 positive regulation of cell population proliferation; GO:0009410 response to xenobiotic stimulus; GO:0009791 post-embryonic development; GO:0009966 regulation of signal transduction; GO:0010765 positive regulation of sodium ion transport; GO:0032024 positive regulation of insulin secretion; GO:0035116 embryonic hindlimb morphogenesis; GO:0035264 multicellular organism growth; GO:0040015 negative regulation of multicellular organism growth; GO:0040032 post-embryonic body morphogenesis; GO:0043588 skin development; GO:0043950 positive regulation of cAMP-mediated signaling; GO:0045669 positive regulation of osteoblast differentiation; GO:0045672 positive regulation of osteoclast differentiation; GO:0045776 negative regulation of blood pressure; GO:0048589 developmental growth; GO:0048701 embryonic cranial skeleton morphogenesis; GO:0050890 cognition; GO:0051216 cartilage development; GO:0060348 bone development; GO:0060789 hair follicle placode formation; GO:0070527 platelet aggregation; GO:0071107 response to parathyroid hormone; GO:0071377 cellular response to glucagon stimulus; GO:0071514 genomic imprinting; GO:0071880 adenylate cyclase-activating adrenergic receptor signaling pathway; GO:0120162 positive regulation of cold-induced thermogenesis; GO:2000828 regulation of parath
  • GO CC:  GO:0001726 ruffle; GO:0005576 extracellular region; GO:0005634 nucleus; GO:0005768 endosome; GO:0005829 cytosol; GO:0005834 heterotrimeric G-protein complex; GO:0005886 plasma membrane; GO:0008021 synaptic vesicle; GO:0016020 membrane; GO:0030142 COPI-coated Golgi to ER transport vesicle; GO:0030425 dendrite; GO:0031410 cytoplasmic vesicle; GO:0032588 trans-Golgi network membrane; GO:0042383 sarcolemma; GO:0043025 neuronal cell body; GO:0045202 synapse; GO:0048471 perinuclear region of cytoplasm; GO:0055037 recycling endosome

Sequence Information

  • Sequence:  LHAL
  • Length:  4(170-173)
  • Propeptide:  MDRRSRAHQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALASSNARAQQRAAQRRSFLNAHHRSAAAAAAAQVLPESSESESDHEHEEAEPELARPECLEYDQDDYETETDSETEPESDIQSETEFETEPETEPETAPTTEPETEPEDERGPRGATFNQSLTQRLHALKLQSADASPRRAQPTTQEPESASEGEEPQREPLDEDPRDPEESEERREANRQPRRCKTRRPARRRDQSPESPPRKGPIPIRR
  • Signal peptide:  MDRRSRAHQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  The GNAS locus is imprinted in a complex manner, giving rise to distinct paternally, maternally and biallelically expressed proteins. The XLas isoforms are paternally derived, the Gnas isoforms are biallelically derived and the Nesp55 isoforms are maternally derived.[Isoform Nesp55]: Shares no sequence similarity with other isoforms due to a novel first exon containing the entire reading frame spliced to shared exon 2 so that exons 2-13 make up the 3'-UTR.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q792G6-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005885_AF2.pdbhor005885_ESM.pdb

Physical Information

Mass: 50626 Formula: C21H36N6O5
Absent amino acids: CDEFGIKMNPQRSTVWY Common amino acids: L
pI: 7.55 Basic residues: 1
Polar residues: 0 Hydrophobic residues: 3
Hydrophobicity: 155 Boman Index: 699
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 220
Instability Index: 750 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  10729789
  • Title:  Neuroendocrine secretory protein 55 (NESP55): alternative splicing onto transcripts of the GNAS gene and posttranslational processing of a maternally expressed protein.